Bacterial taxon 400667
Locus A1S_1988
Protein ABO12415.1
putative intracellular sulfur oxidation protein (DsrE-like)
Acinetobacter baumannii ATCC 17978
Length 122 aa, Gene n/a, UniProt n/a
>ABO12415.1|Acinetobacter baumannii ATCC 17978|putative intracellular sulfur oxidation protein (DsrE-like)
MSTLLLITSAPTSIHAWHALGLAQALKSKNEDFRVFFYQDGVQVANDFQWVPDDQRNLTHEWQKLSIRLPVCVSAALARGITDAENASRHQLSHHNLANNFELVGLGELADAVQSASRLLQF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.13 | 3.6e-8 | ●●●○○ -2.89 | -2.8872558322209096 | 24895306 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)