Bacterial taxon 400667
Locus A1S_1034
Protein ABO11466.2
putative ligase
Acinetobacter baumannii ATCC 17978
Length 194 aa, Gene n/a, UniProt n/a
>ABO11466.2|Acinetobacter baumannii ATCC 17978|putative ligase
MNELSFIRKNLRSRRRALTQFEQKQAQLNVLHCLNHLPIFHSSKKIGLYLHAFGEIHTDLLIKLCFKKNKQVYLPMICSMNQRLVWVKINKNQYLSRRFSHHPLGMKEPMATRGKHVSQLDLLLMPLLACDHYGTRIGMGGGYYDRTLASAKHKPYRLGLAHQFQFIEHTLERQSWDQPLDGLLTPQHFYYFKR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.92 | 1.0e-27 | ●●●○○ -2.59 | -2.588295155360535 | 24895306 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)