Bacterial taxon 400667
Locus A1S_2609
Protein ABO13026.2
putative lipid A biosynthesis lauroyl acyltransferase
Acinetobacter baumannii ATCC 17978
Length 319 aa, Gene n/a, UniProt n/a
>ABO13026.2|Acinetobacter baumannii ATCC 17978|putative lipid A biosynthesis lauroyl acyltransferase
MNYQLLKTFSRQPIQFGRFLARLLAGLVNTLKITRTSKSIELNLRIALPYLTPQQRIAITEKAVRNELTSYFEFLSIWGSSNSKNISRIHRIEGEHFFHEALAAKKGVVLIVPHFGTWEVMNAWCAQFTSMTILYKPVKNADADRFVREARSREQANLVPTDESGVRQIFKALKQGETTVILPDHTPNVGGDMVNYFGVPLASSNLSAKLIQKTKAKALFLYAIRNENDGFTMHIEPMDEKIYEGTADDGTYVIHQAIEQLIYQYPEHYHWSYKRFKANPALDNIYNIDPTEALKIVDRLKAEALKTSTQPEPIQTSVM
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.86 | 4.3e-9 | ●●○○○ -1.04 | -1.0403107161600171 | 24895306 |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)