Bacterial taxon 400667
Locus A1S_1689
Protein ABO12116.2
putative membrane protein
Acinetobacter baumannii ATCC 17978
Length 128 aa, Gene n/a, UniProt n/a
>ABO12116.2|Acinetobacter baumannii ATCC 17978|putative membrane protein
MREDQAGILNQLLSSLDAIPEEIIALTAYGVGAIIALWCWWRLMRRLPTTLGAISWLVVFAILVTPTVSEGPNASVAPAIFGLLFGVLTKDSPLIWSNLSLILFVIGLGLVIGYCWSKYITNKSMRSI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.97 | 4.8e-13 | ○○○○○ 1.63 | 1.631127127788675 | 24895306 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)