Bacterial taxon 400667
Locus A1S_1706
Protein ABO12133.1
putative membrane protein
Acinetobacter baumannii ATCC 17978
Length 214 aa, Gene n/a, UniProt n/a
>ABO12133.1|Acinetobacter baumannii ATCC 17978|putative membrane protein
MVWLSYYHWIQIPTVPAIGFTIFGVILSICTGFRNNACYDRWWEGRKLWGALIANARHIVRDSHVLSNEKREHLIHQVLIFSNLLRDRLRQQTVEPTKFLEHAYLNNSSLNYLNEHINAPQFVLENIQKDLVKALKDGEISDIIYSTLNRHIIELGNIQAGCDRIAGTPLPYSYSVLLHRAVYCFCFILPFSLEAALGIWTPLIVGLIAYMFLD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.7 | 0.00012 | ○○○○○ 1.24 | 1.2362095836932694 | 24895306 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)