Bacterial taxon 400667
Locus A1S_1710
Protein ABO12137.2
putative membrane protein
Acinetobacter baumannii ATCC 17978
Length 263 aa, Gene n/a, UniProt n/a
>ABO12137.2|Acinetobacter baumannii ATCC 17978|putative membrane protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANTISPIWLMLMFSLVMFTVGYRLISNRVSDFHNPPCQVNPSTGRFIWNFKTGSVLASIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFHYPVAITSAFALACAFGMLLGRRAIRFIPSAIVQRVFALMVFAVAIYMVIKIVNLTNI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.7 | 4.3e-37 | ●●●○○ -2.26 | -2.2589937063800836 | 24895306 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)