Bacterial taxon 400667
Locus A1S_3444
Protein ABO13833.2
putative membrane protein
Acinetobacter baumannii ATCC 17978
Length 125 aa, Gene n/a, UniProt n/a
>ABO13833.2|Acinetobacter baumannii ATCC 17978|putative membrane protein
MGQDHIEQHRRYIVISYAFMFLALFTVIFAAFAYLVARKVAVVDDAEVWIHAHALWIMRNGILFLLMSVFAVVWFIPLFFFAWDSNLWVTASTVAGVVFSAIAWLFLLNAWLKGLSKYLKNKAVF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.86 | 3.0e-8 | ●●○○○ -1.04 | -1.0350719065677223 | 24895306 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)