Bacterial taxon 400667   Locus A1S_1778   Protein ABO12205.1

putative methylenetetrahydrofolate reductase

Acinetobacter baumannii ATCC 17978

Length 84 aa, Gene n/a, UniProt n/a

>ABO12205.1|Acinetobacter baumannii ATCC 17978|putative methylenetetrahydrofolate reductase
MSHVSPCFQQNQFFVLVEYLTSLHEIYPVRHEFAGYPAAMTLADRVHSDHDIAPLEASKSYPESIDKVLHFSGKARDIQDFEHF

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)lung BTO:000076324 hnot available in this study0.60.041○○○○○ 1.11.097456589121086324895306
Retrieved 1 of 1 entries in 1.2 ms (Link to these results)