Bacterial taxon 400667
Locus A1S_0540
Protein ABO10993.2
putative minor lipoprotein
Acinetobacter baumannii ATCC 17978
Length 169 aa, Gene n/a, UniProt n/a
>ABO10993.2|Acinetobacter baumannii ATCC 17978|putative minor lipoprotein
MHLAQRLAAVVLTLGLSAGLVGCGFHLKGTNPTATPLVYKKLSLELPAKTDDLETQLKVYLTANGVQLSNDNDAYVLRVLEYTPRRQLLNGKLTEVLLRLTVTFQIEDRQGNKITEPRTLTAARSYQYDLATVNTENQQESYLQRIVIDDLAQQITRQISANRLPKAQP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.02 | 1.4e-7 | ●●○○○ -1.28 | -1.2751836376620813 | 24895306 |
Retrieved 1 of 1 entries in 6.8 ms
(Link to these results)