Bacterial taxon 400667
Locus A1S_1549
Protein ABO11976.2
putative nucleotidyl transferase
Acinetobacter baumannii ATCC 17978
Length 229 aa, Gene n/a, UniProt n/a
>ABO11976.2|Acinetobacter baumannii ATCC 17978|putative nucleotidyl transferase
MKAMILAAGLGNRMRPLTLYTPKPLLEVGGKPLIVWHIEKLKKIGVTEIVINSAWLADKLISSLGDGSQFGVDIRWTREEEGLETAGGIINALPLLGTDPFILVNGDVWTTMDFEALRHIKLNDDLAHLVLVDNPKQHPDGDFTLLNGRAFTFDQDVKGENLTFSGVSVIHPKLFDGLEAGKRPLAPLLKQAMHNQKISGEKLKGAWVDVGTPERLMELDLQIREGFYD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.5 | 2.1e-12 | ●●○○○ -1.96 | -1.9648181483034484 | 24895306 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)