Bacterial taxon 400667
Locus A1S_2540
Protein ABO12957.1
putative organic radical activating enzyme
Acinetobacter baumannii ATCC 17978
Length 124 aa, Gene n/a, UniProt n/a
>ABO12957.1|Acinetobacter baumannii ATCC 17978|putative organic radical activating enzyme
MQGEANASGLPTVFIRLTGCPLRCSYCDTTYSFEGGERLSLEHIIETAEKYQTPYICVTGGEPLAQPNCLILLQRLCDAGFDVSLETSGALDVSRVDPRVSKVLDLKTPTSGENTVISSVILTI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.38 | 0.024 | ●○○○○ -0.34 | -0.3403612326458848 | 24895306 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)