Bacterial taxon 400667
Locus A1S_2734
Protein ABO13147.2
putative phosphatidylglycerophosphatase B
Acinetobacter baumannii ATCC 17978
Length 208 aa, Gene n/a, UniProt n/a
>ABO13147.2|Acinetobacter baumannii ATCC 17978|putative phosphatidylglycerophosphatase B
MPYLLLCIGCVFLGLGVLGLFVPSLQSLDLLTVQTLSHHRLDYLNTITTFLARVGGMPFVCFLSFLVCIYLAWYKKYITVIFISLGVIGSITMGWLLKWCVNRPRPPEAYHIVESYGASFPSAHSVYASTLACLAMIMLCHKHNINSPYIVLISCLWFVCMGLSRIYAGVHFPTDVLAGWGIGFIWIALLWLWLLQTQSRLSRKQIYF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.66 | 0.0011 | ○○○○○ 1.18 | 1.1782615392833702 | 24895306 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)