Bacterial taxon 400667
Locus A1S_2440
Protein ABO12858.1
putative purine metabolism protein
Acinetobacter baumannii ATCC 17978
Length 244 aa, Gene hflD, UniProt A3M7G4
>ABO12858.1|Acinetobacter baumannii ATCC 17978|putative purine metabolism protein
MVELPFQQSQALNVRQNRALALAGVFQATQLTHMTAMTGQQSIGESGNFYFELLIKASLNIRPTTNNNTVQTLDFFNQLADISLGLKTLENCITQPFSNAPKSRLPKMRSAKLPMSYAMSLLQLEKKVYSNPEYVAIIEKAQQKILKQLSFFDNNYLHPSILANLAQTYVDTAGQINPRILVRGNAEAFKDTNHTNRIRACLFTGLQMAHLWRQLGGSSWNMIFSKRKLLQDIQALARLQYQVI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.96 | 0.0097 | ●●○○○ -1.18 | -1.181298707015963 | 24895306 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)