Bacterial taxon 400667
Locus A1S_1801
Protein ABO12228.1
Putative RND family drug transporter
Acinetobacter baumannii ATCC 17978
Length 53 aa, Gene n/a, UniProt n/a
>ABO12228.1|Acinetobacter baumannii ATCC 17978|Putative RND family drug transporter
MHSSRQISATNATGNFTKIVQRLPLRIKLLENQPDIKLLRPGLSVVVSVDTTK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.2 | 2.3e-51 | ●●●●● -4.45 | -4.454633978187307 | 24895306 |
Retrieved 1 of 1 entries in 109.4 ms
(Link to these results)