Bacterial taxon 400667
Locus A1S_1657
Protein ABO12084.2
putative siderophore biosynthesis protein; putative acetyltransferase
Acinetobacter baumannii ATCC 17978
Length 206 aa, Gene n/a, UniProt n/a
>ABO12084.2|Acinetobacter baumannii ATCC 17978|putative siderophore biosynthesis protein; putative acetyltransferase
MLTLSQKLPDYFEYIENDVSYSLRQVQYPQDIPLLHRWMHEPHVIPQWQLNKSEIELKVYFEKMLADDHQRLMIVGINGQDVGYAEIYEGKRDRLARYYKGEDNDLGWHLLFGEKSAFGQGFLRPTIRLLNFYIFENSPTNRIVGEPDHTVKPYAAVVEDMCYEEQGLIPMPEKTAMLYYCFREKFYDRFFELYQASQQKLQQKAS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.75 | 0.0031 | ●○○○○ -0.88 | -0.8804266589067167 | 24895306 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)