Bacterial taxon 400667
Locus A1S_2563
Protein ABO12980.1
putative siderophore-interacting protein
Acinetobacter baumannii ATCC 17978
Length 201 aa, Gene n/a, UniProt n/a
>ABO12980.1|Acinetobacter baumannii ATCC 17978|putative siderophore-interacting protein
MKHLSAPKRQKLMESMNKDVRLYTLRKAFAHGSNGEDLHFGYVDVFTHGASPGSQWVQQLNTGSLISSRTETDDKHEHLHEGQAVLIADETAFPALAGILDFWKNPIPPIVILLSADAVDFAYFDDFSFPENTNLQKITGAVHEQGSQTVELLKTFDQLDQVWGALENNAAKQIRHYFRNERKLAGKNNHIKGYWRLSKAH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.65 | 0.0078 | ●○○○○ -0.72 | -0.7246662236037269 | 24895306 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)