Bacterial taxon 400667
Locus A1S_0033
Protein ABO10528.2
putative signal peptide
Acinetobacter baumannii ATCC 17978
Length 136 aa, Gene n/a, UniProt n/a
>ABO10528.2|Acinetobacter baumannii ATCC 17978|putative signal peptide
MKKLFTILALCITVLTTSMASFADPPFDRGHGPKGPKGGPRGEWNDRGHKFDRDDNGDRVRDERRMREERGFERLKQHRWQPGYVMPQHYRGNGYKVDYKDNNLPKPDRNQQWYKINNDYILVDTDSNSIVSIRGF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.31 | 1.7e-38 | ●●●●● -4.6 | -4.60437408672973 | 24895306 |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)