Bacterial taxon 400667
Locus A1S_1679
Protein ABO12106.2
putative signal peptide
Acinetobacter baumannii ATCC 17978
Length 89 aa, Gene n/a, UniProt n/a
>ABO12106.2|Acinetobacter baumannii ATCC 17978|putative signal peptide
MNKLMVAVFAGMVTLAGFSAQAATPEQECQKLQDDYNLIYASKGFCFKDQDAKEKYGNENCHTTKPKFSDKEQQRLDAIKERQKELKCK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.51 | 0.01 | ○○○○○ 0.96 | 0.95745998766789 | 24895306 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)