Bacterial taxon 400667
Locus A1S_1991
Protein ABO12418.1
putative sulfite reductase
Acinetobacter baumannii ATCC 17978
Length 103 aa, Gene n/a, UniProt n/a
>ABO12418.1|Acinetobacter baumannii ATCC 17978|putative sulfite reductase
MNLELDQDGHLVDYTIWNPEVAQELAKSLDLELTDWHFEVLAAVRQFYQQFGHSPATRPLIKFLMKTVSPDINNAVLQQKFNTGLVARHLSRLAGIPKPANCL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.87 | 0.0054 | ●●○○○ -1.06 | -1.0565971523221724 | 24895306 |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)