Bacterial taxon 400667
Locus A1S_3100
Protein ABO13497.2
putative toluene tolerance protein (Ttg2D)
Acinetobacter baumannii ATCC 17978
Length 191 aa, Gene n/a, UniProt n/a
>ABO13497.2|Acinetobacter baumannii ATCC 17978|putative toluene tolerance protein (Ttg2D)
MNTLFKQTLTASILSTMIAGTAFAAPSEAPPDFIKRVADGLISRLKADHAKLQNNPALVKTIVRQNLDPYVDSQAFTRIVMGTYATNQYSTAAQRAQFETNFRNTLIENYGSAFAKYTNQTYTMRPYKVTAGKNPVVTLDFNHNGEKIPVSFQLADKGSQWKIRNINVSGIDLGLQFRNQFAATVKRNGVI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -4.29 | 1.7e-71 | ●●●●● -6.03 | -6.033532730025597 | 24895306 |
Retrieved 1 of 1 entries in 54.4 ms
(Link to these results)