Bacterial taxon 400667
Locus A1S_0739
Protein ABO11179.1
putative transcriptional regulator
Acinetobacter baumannii ATCC 17978
Length 183 aa, Gene n/a, UniProt n/a
>ABO11179.1|Acinetobacter baumannii ATCC 17978|putative transcriptional regulator
MPTLEISSKKLQVVQTAIQLFTTHGFHNAGVDLIIKEAKIPKATFYNYFHSKERLIEMCIAFQKSLLKEEVLSIIYSSRYYTQKDKLKEIIVLHTNLNSLYHLLLKAVFEIKRLYPQAYRMAVEYRKWLHRELFDLIFSCETRAFKFDADMVLNLIDGLLLQVLSSNSVDERDVVLERFWGRA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.88 | 1.2e-9 | ●●○○○ -1.07 | -1.0706853100826672 | 24895306 |
Retrieved 1 of 1 entries in 8.7 ms
(Link to these results)