Bacterial taxon 400667
Locus A1S_1007
Protein ABO11439.1
putative transcriptional regulator
Acinetobacter baumannii ATCC 17978
Length 108 aa, Gene n/a, UniProt n/a
>ABO11439.1|Acinetobacter baumannii ATCC 17978|putative transcriptional regulator
MSNILRRLRNLFNDPLLIRSSEGMTPTERALELQPRIRDALSDLSMILEPRTEFRPYTSNRVFRIMTSDYAEATLVPRLVKALRSEAPNVVLDFLTPSDVSYKRHGTG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.45 | 0.03 | ●○○○○ -0.43 | -0.43366971223475925 | 24895306 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)