Bacterial taxon 400667
Locus A1S_0625
Protein ABO11074.2
putative transcriptional regulator (TetR family)
Acinetobacter baumannii ATCC 17978
Length 190 aa, Gene n/a, UniProt n/a
>ABO11074.2|Acinetobacter baumannii ATCC 17978|putative transcriptional regulator (TetR family)
MEFEIMTKVISKRKTILDTALSLFKQYSFKFVGVDRIINESQVAKMTFYKHFPSKTLLIQACLCEEQKTIEESILNELSLLSEAGNIARLKALLNWHVAYINQQNFNGCLFQKAVYENEVSEEVLSVIQAHKQWKFKLVSDLMEVPECCTAFVSSSMVYSMLEGMLLPANINPCVDHETAIKNLIQTFEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.57 | 0.00016 | ○○○○○ 1.04 | 1.0444074366482474 | 24895306 |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)