Bacterial taxon 400667
Locus A1S_1125
Protein ABO11555.2
putative transferase
Acinetobacter baumannii ATCC 17978
Length 291 aa, Gene n/a, UniProt n/a
>ABO11555.2|Acinetobacter baumannii ATCC 17978|putative transferase
MKEGQSSRTAEAAAALRANHFKNTTNPVFSDPYAFEMTSKGWKKLLSTPLIVKLMNSPILNRTLGLLSGQVVGRSRYAEDLLNQAVQHNIEQYVLVGAGLDSFVLRKSQHYPTLKIFEVDHPDTQAAKQSKLKKLGELPSTVEFVSINFEKESISEALARSRYVRKTPAFFSWLGTTHYLKPDTTLQTLKSIAEFAANGSEVVLDYSTDFQELKGIERLGSMGVAQFTHLLKEPLLGQFKPSDLHQAVEKMGFEVVEDLSGEAITERYFYNRADNICHTSATRLLHLRLKK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.68 | 1.4e-35 | ●●●○○ -2.24 | -2.2381987437299222 | 24895306 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)