Bacterial taxon 400667
Locus A1S_3029
Protein ABO13426.1
putative tRNA-i(6)A37 modification enzyme
Acinetobacter baumannii ATCC 17978
Length 246 aa, Gene n/a, UniProt n/a
>ABO13426.1|Acinetobacter baumannii ATCC 17978|putative tRNA-i(6)A37 modification enzyme
MNGYRGETFEGGICTFPELLRLVAEIPGIGRLRYTTSHPLEFSDELIQCYEDLPQMVSHLHLPVQSGSNDVLKAMKRNHTIDVYIDKIAKLRKIRPDMHLSSDFIIGFPGETDENFAKTLQFIKDLDFDHSYSFVYSKRPGTPASDLPDTTPEHVKKERLAQVQQVIKQSSIEKTDAMLGKIERVLIEKVSDQDPNILVGTADNTRLVTFVGDASWVGRFAEIEITEIKTLNLVYGELLNLEPDVA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.6 | 2.7e-5 | ●○○○○ -0.66 | -0.6578342647582736 | 24895306 |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)