Bacterial taxon 400667
Locus A1S_2134
Protein ABO12561.2
putative ubiquinone biosynthesis protein
Acinetobacter baumannii ATCC 17978
Length 211 aa, Gene coq7, UniProt A3M6L7
>ABO12561.2|Acinetobacter baumannii ATCC 17978|putative ubiquinone biosynthesis protein
MRHYTGIDQLINSFDQALRSLVPGATAAQRQNPAETVEAKLGVEDARHVAGLMRVNHSGEVCAQALYHGQALTAKLPNVRREMQQAAIEEQDHLAWCEDRLKELNSHTSLLNPIWYGLSYGMGALAGIAGDKYSLGFVAETERQVSLHLQDHLNQLPAQDERSRKILEQMNEDELHHRHTALEAGGVELPYAVKITMTAISKLMTKTSYYL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.46 | 8.7e-5 | ●●○○○ -1.92 | -1.9169126487870078 | 24895306 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)