Bacterial taxon 400667
Locus A1S_0654
Protein ABO11103.2
regulatory protein ArsR
Acinetobacter baumannii ATCC 17978
Length 102 aa, Gene n/a, UniProt n/a
>ABO11103.2|Acinetobacter baumannii ATCC 17978|regulatory protein ArsR
MRLLVVAGAEGMASGQIAEALDGAAPSRISFHLSHLENAGLIYSRREGRQIIYCAIWSTLADLVAFLMHDCCQGHCEYCDKAIELFAKCTGEPTEGYIKIGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.72 | 5.0e-6 | ○○○○○ 1.27 | 1.2672512409993597 | 24895306 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)