Bacterial taxon 400667
Locus A1S_2175
Protein ABO12602.1
replicative DNA helicase;chromosome replication chain elongation
Acinetobacter baumannii ATCC 17978
Length 234 aa, Gene n/a, UniProt n/a
>ABO12602.1|Acinetobacter baumannii ATCC 17978|replicative DNA helicase;chromosome replication chain elongation
MNLVESVLQYNKLPALVFSMEMPADSIAMRLISAMGKVHQGHLRSGNLDADEWTKVTGTILQLQQMHLYIDDSSALPPTEVRARARRIAKMHDGKIGCIMVDYLQLMKVPGMGDNRVGEISEISRSLKALAKEMNCPVIALSQLNRSLENRPNKRPVMSDLRESGAIEQDADLIMFIYRDEVYNKESKEAGTAEIIIGKQRNGPIGTVRLAFEGQYTRFSNLSPEYYSQYDDEE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.43 | 8.7e-7 | ●●○○○ -1.87 | -1.8695448846004141 | 24895306 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)