Bacterial taxon 400667
Locus A1S_0338
Protein ABO10798.2
ribosome-binding factor A
Acinetobacter baumannii ATCC 17978
Length 133 aa, Gene rbfA, UniProt A3M1K4
>ABO10798.2|Acinetobacter baumannii ATCC 17978|ribosome-binding factor A
MAGGQRLKRMADSVQRELSELIRQELKDPRLGGLVTISGVKVSPDLGYADVYVTVMGRELSDDQNEVAHRETLDILNKASGFLRQELSRRIKTRITPRLRFHYDKTNAYGNYMFGLIEKAVQDLPKRESDDEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.48 | 0.0019 | ○○○○○ 0.92 | 0.9150032772990533 | 24895306 |
Retrieved 1 of 1 entries in 2.4 ms
(Link to these results)