Bacterial taxon 400667
Locus A1S_2779
Protein ABO13191.2
rod shape-determining protein
Acinetobacter baumannii ATCC 17978
Length 163 aa, Gene n/a, UniProt n/a
>ABO13191.2|Acinetobacter baumannii ATCC 17978|rod shape-determining protein
MPIAKLKREKRKDPLWGIILSIIVGSVLMIYPLSYDISGWRPLFMLMIMLFWVVCQPTWCGVWFAFGMGIFTDLLLDAPLGLNALSFVIVTFITRFLIRERRILTFGNLWTIATLVIIAHLAFMWVTQTMGGIHFSIARHWQPLMTSILTWPVVYYCLAKWRN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.82 | 4.6e-8 | ●○○○○ -0.97 | -0.9732138800551033 | 24895306 |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)