Bacterial taxon 400667
Locus A1S_0016
Protein ABO10513.1
site-specific tyrosine recombinase
Acinetobacter baumannii ATCC 17978
Length 310 aa, Gene n/a, UniProt n/a
>ABO10513.1|Acinetobacter baumannii ATCC 17978|site-specific tyrosine recombinase
MLDREILLKKWLDEYLLANKSNETIYTLKNSLNLFFEYTNLALEEIEASDIRTFIAYRAQNGVGVSTLKKNISAIRTFFHYLTKEKLINFNPAEDIKIKKSSKVLPKFHEVTVINEVLDSNKNLEFERPSSTVIFKRDLALIEIAYSCGLRLEEIHSLQIENVEVKRKQVRVTGKGNKTRIIPLGSKAIEAYLEWLPLREEIMNKDTNQKHNYVFVTTTGAQLSRVQINKRIKNAFKLAGYPIQSNPHMLRHSFATHLINNSVGIREIQEMLGHSNLNTTQIYTDLDHTSMTNVYMDTHPRAVKNTEGEN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.54 | 0.00044 | ○○○○○ 1 | 1.0037686922659568 | 24895306 |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)