Bacterial taxon 400667
Locus A1S_3128
Protein ABO13525.2
succinylglutamate desuccinylase
Acinetobacter baumannii ATCC 17978
Length 324 aa, Gene astE, UniProt A3M9D1
>ABO13525.2|Acinetobacter baumannii ATCC 17978|succinylglutamate desuccinylase
MQDFLALTLQGEQPATREGKQANFSWRWLGEGLLECTPHAQYDKAVVLSAGVHGNETAPIELLSHLCTDLFAGRLKLAVRLLLVLGNPYAMRQGKRYVHDDVNRMFCGGYKNLPVTEESKRAEVLEQTVATFFQESSSQAKRYHYDLHTAIRASLLPTFALFPYQTHSYDADLTASLEAADLDALVYHNAVGKTFTHFTSENFKAASATLELGKALPFGQNDLSQFASIDEVIRNVVSEQALPVRNKPKIRVFQVSDSLIKKDEEFHMNLSAEAPNFSTFTKGEIIATQPSGNYVVEQDQVWILFPNPNVKIGLRAGLVLTETI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.72 | 4.3e-5 | ●○○○○ -0.84 | -0.839908488743476 | 24895306 |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)