Bacterial taxon 400667
Locus A1S_3101
Protein ABO13498.2
toluene tolerance efflux transporter
Acinetobacter baumannii ATCC 17978
Length 226 aa, Gene n/a, UniProt n/a
>ABO13498.2|Acinetobacter baumannii ATCC 17978|toluene tolerance efflux transporter
MKSRTSELAVGIFVIIFGIALFFLAMKVSGLVGTNLSDGYTMKAQFDNVNGLKPRAKVTMSGVTIGRVDSITLDPVTRLATVTFDLDGKLTSFNAEQLKEVQKNALDELRYSSDYTQATPAQQKTMEQQLISNMNSITSIDEDAYIMVATNGLLGEKYLKIVPGGGLNYLKRGDTISNTQGTMDLEDLISKFITGGGAGKVAAGSSSAEEKAPASTDSSAQPSFVE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.54 | 2.1e-34 | ●●●●● -4.94 | -4.941537362910086 | 24895306 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)