Bacterial taxon 400667   Locus A1S_3101   Protein ABO13498.2

toluene tolerance efflux transporter

Acinetobacter baumannii ATCC 17978

Length 226 aa, Gene n/a, UniProt n/a

>ABO13498.2|Acinetobacter baumannii ATCC 17978|toluene tolerance efflux transporter
MKSRTSELAVGIFVIIFGIALFFLAMKVSGLVGTNLSDGYTMKAQFDNVNGLKPRAKVTMSGVTIGRVDSITLDPVTRLATVTFDLDGKLTSFNAEQLKEVQKNALDELRYSSDYTQATPAQQKTMEQQLISNMNSITSIDEDAYIMVATNGLLGEKYLKIVPGGGLNYLKRGDTISNTQGTMDLEDLISKFITGGGAGKVAAGSSSAEEKAPASTDSSAQPSFVE
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)lung BTO:000076324 hnot available in this study-3.542.1e-34●●●●● -4.94-4.94153736291008624895306
Retrieved 1 of 1 entries in 1.2 ms (Link to these results)