Bacterial taxon 400667
Locus A1S_1823
Protein ABO12250.2
Transcriptional Regulator TetR family
Acinetobacter baumannii ATCC 17978
Length 191 aa, Gene n/a, UniProt n/a
>ABO12250.2|Acinetobacter baumannii ATCC 17978|Transcriptional Regulator TetR family
MYMARPRSEDKRNAILSAAIETLAELGERASTSKIAKVAGVAEGTLFTYFSNKEELLNQLYLSLKAELRQVMMLSYPTNADLQTQMSHIWQSYLDWSLEAPLKRKVMAQLSTSEQITEQSKQIGMQTFCDFTQNIQERINDGKLRDYPPLFIASILGALAEVTLNFIAQDPSQAERYRKSGFEAFWHAVSI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.36 | 0.022 | ○○○○○ 0.74 | 0.7446813793231482 | 24895306 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)