Bacterial taxon 400667
Locus A1S_0677
Protein ABO11125.1
transposase
Acinetobacter baumannii ATCC 17978
Length 55 aa, Gene n/a, UniProt n/a
>ABO11125.1|Acinetobacter baumannii ATCC 17978|transposase
MKLYISALQLENGELLLVVSPQFNANAIQDYALRWEIETLFSCLKGRGFNLEIRA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.56 | 0.00068 | ○○○○○ 1.03 | 1.0343809480603916 | 24895306 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)