Bacterial taxon 354242
Locus CJJ81176_1125
Protein WP_002856038.1
ATP-dependent Clp protease adaptor ClpS
Campylobacter jejuni subsp. jejuni 81-176
Length 96 aa, Gene clpS, UniProt A1W094
>WP_002856038.1|Campylobacter jejuni subsp. jejuni 81-176|ATP-dependent Clp protease adaptor ClpS
MPKTQTLEQTKLSEPKMYKVILLNDDVTTMDFVIEILMNIFHQNLEKASQTMLEIHHNGSGICGIYTQEIALSKQKKVIDAAKLANFPLQAKVEEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 7 days | not available in this study | -6.54 | 0.039 | ●●○○○ -1.83 | -1.8264952585 | 28542173 |
Retrieved 1 of 1 entries in 17.2 ms
(Link to these results)