Bacterial taxon 354242
Locus CJJ81176_1675
Protein WP_002869285.1
citrate synthase
Campylobacter jejuni subsp. jejuni 81-176
Length 422 aa, Gene gltA, UniProt A0A0H3PI81
>WP_002869285.1|Campylobacter jejuni subsp. jejuni 81-176|citrate synthase
MSNSVTITDNRNGKSYEFPIYDGTTGPSVVDMSSFYKQTGMFSYDEGLTSTATCKSKITYIDGENGILMHRGYPIEWLAENKLYLDVVHLLLYKELPDATRLEAFRYEMKKRSFIHEGMHRLFDSFPDNAHPMAVLQGAVSSLSAFYPDHLNMNVKEEYMEMAARIVAKIPTIAATAYRYKHGFPMAYPNLDRGFTENFLYMLRTYPYDHVELKPIEVKALDTVFMLHADHEQNASTSTVRAVGSTHAHPYACIAAGIGALWGHAHGGANEGVIRMLEQIGSVDRVDEFIKRAKDKNDPFRLMGFGHRVYKNFDPRAKVLKKLRDQLIDELGIDTNLIKVATRIEEIALSDDYFVQRGLYPNVDFHSGLILKALGIPNEMFATLFVIGRTPGWIAQWIEQKEQESLKIVRPRQLYLGETSKI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 7 days | not available in this study | -9.11 | 0.0014 | ●●●●○ -3.16 | -3.16312136747 | 28542173 |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 21 days | not available in this study | -8.89 | 0.002 | ●●●●○ -3.05 | -3.04713990582 | 28542173 |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 4 days | not available in this study | -6.42 | 0.043 | ●●○○○ -1.77 | -1.76752029934 | 28542173 |
Retrieved 3 of 3 entries in 4.1 ms
(Link to these results)