Bacterial taxon 354242
Locus CJJ81176_1516
Protein WP_002855997.1
diaminopimelate epimerase
Campylobacter jejuni subsp. jejuni 81-176
Length 249 aa, Gene dapF, UniProt A1W1D0
>WP_002855997.1|Campylobacter jejuni subsp. jejuni 81-176|diaminopimelate epimerase
MKFYKYCASGNDFVITNADRKEDRSALAKELCNRYEGIGADGFIVILPHEKYDFEWEFYNNDGSRAAMCGNGSRAAAHFAHHINKINPNMSFLTGAGVIKAKVNQDKVEVSLGKIKSVQNTFEELGKTWQLCNTGVPHLVHFCQNLDEFDTMLCQKMRQKYNANVNFVKILDENHLKVRTYERGVEDETLACGTGMGACFYLAFLNKKVQNKVKITPKSGEEVGFAYKNEELFFEGKVKYCFEANYNFS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 4 days | not available in this study | 1.62 | 0.011 | ○○○○○ 2.41 | 2.41178448766 | 28542173 |
Retrieved 1 of 1 entries in 40.7 ms
(Link to these results)