Bacterial taxon 354242
Locus CJJ81176_1571
Protein WP_002869224.1
dimethylsulfoxide reductase subunit B
Campylobacter jejuni subsp. jejuni 81-176
Length 218 aa, Gene dmsB, UniProt Q0Q7H8
>WP_002869224.1|Campylobacter jejuni subsp. jejuni 81-176|dimethylsulfoxide reductase subunit B
MKLEENSQFGFMLDQSKCVGCRTCSLSCKDYKNMPVGINFRRVFETEGGNWTAKEDGSFEQSVFAYYTSISCNHCSNPSCLKACPTGATMKIKWGIVAIDDSMCIGCKACAMACPYGAPQFNHESGHMSKCDGCYERLKEGKNPICVDSCPFRALKAGDITKLREEHGNLASITPLPDASITHPNLCIVPEKHSLPSGNKSTIFHLPQNYQGVKNDII
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 21 days | not available in this study | 2.75 | 0.0023 | ○○○○○ 3 | 3.00032295072 | 28542173 |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 7 days | not available in this study | 3.93 | 0.0003 | ○○○○○ 3.61 | 3.61240930454 | 28542173 |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 4 days | not available in this study | 4.23 | 0.00017 | ○○○○○ 3.77 | 3.76632689352 | 28542173 |
Retrieved 3 of 3 entries in 44 ms
(Link to these results)