Bacterial taxon 354242
Locus CJJ81176_0193
Protein WP_002851635.1
membrane protein
Campylobacter jejuni subsp. jejuni 81-176
Length 135 aa, Gene n/a, UniProt A0A0H3PIX0
>WP_002851635.1|Campylobacter jejuni subsp. jejuni 81-176|membrane protein
MDQSYEFFLALHLYSLYASGFLMLFYLILTQGNFKTEFIFIRRIRLFLPIYYLFLALIIFTGCLLSAMKQFQMNVNIWVMIFSWILIFALAIFHFVCFKKARRFRKYATFRWISCLILPFEIFLLFLPFLIERYL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 4 days | not available in this study | 0.29 | 0.047 | ○○○○○ 1.72 | 1.7204166219 | 28542173 |
Retrieved 1 of 1 entries in 21.8 ms
(Link to these results)