Bacterial taxon 354242
Locus CJJ81176_0101
Protein WP_002851985.1
MinD/ParA family protein
Campylobacter jejuni subsp. jejuni 81-176
Length 288 aa, Gene n/a, UniProt A0A0H3PCJ0
>WP_002851985.1|Campylobacter jejuni subsp. jejuni 81-176|MinD/ParA family protein
MNNQANKLRNLMSQNGTKKSQNTHFIAITSGKGGVGKSTISANLANVLANNGYKVGLFDADIGLANLDVILNVRIQKNLLHVLRGECSLEDILIEVKPNLWLIPGESGDEILKYNDKNIYERFLNQASILDELDFLIIDTGAGIGGNILNFLEMADEVIVVTVPDPAAITDAYATIKTTSKTKENLLMLFNVVKNENEALKVFENIKKVADANIKNPLNLEFLGHLSASKDVSGSIKKRTLFSDENTASSDEIKALASKLLYRLERKVLDNVSNRSFSSFFRKIIERF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 21 days | not available in this study | -8.19 | 0.0056 | ●●●○○ -2.69 | -2.68721234811 | 28542173 |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 7 days | not available in this study | -7.34 | 0.017 | ●●●○○ -2.24 | -2.24240033336 | 28542173 |
Retrieved 2 of 2 entries in 39.1 ms
(Link to these results)