Bacterial taxon 354242
Locus CJJ81176_0449
Protein WP_009882169.1
YigZ family protein
Campylobacter jejuni subsp. jejuni 81-176
Length 194 aa, Gene n/a, UniProt A0A0H3PJ82
>WP_009882169.1|Campylobacter jejuni subsp. jejuni 81-176|YigZ family protein
MQTINQIFQTQIDIKKSIFLSFLCPFKDFKFLIETLKKEHPKAVHFVYAYRVLNDFNQIVEDKSDDGEPKGTSGMPTLNVLRGYDLINAALITVRYFGGIKLGTGGLARAYSDAANAVINNSSLLSFELKKNISIAIDLKNLNRFEYFLKTYSFNFTKDFKDCKAILHIKLNEKEDQEFEIFCKNFAPFEIEKL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 21 days | not available in this study | 3.73 | 0.00044 | ○○○○○ 3.51 | 3.50861985024 | 28542173 |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 7 days | not available in this study | 6.49 | 1.0e-6 | ○○○○○ 4.95 | 4.9457584487 | 28542173 |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 4 days | not available in this study | 9.1 | 5.0e-10 | ○○○○○ 6.3 | 6.29933201337 | 28542173 |
Retrieved 3 of 3 entries in 22.1 ms
(Link to these results)