Bacterial taxon 199310
Locus c1688
Protein AAN80155.1
Respiratory nitrate reductase 1 gamma chain
Escherichia coli CFT073
Length 225 aa, Gene narI, UniProt A0A0H2V978
>AAN80155.1|Escherichia coli CFT073|Respiratory nitrate reductase 1 gamma chain
MQFLNMFFFDIYPYIAGAVFLIGSWLRYDYGQYTWRAASSQMLDRKGMNLASNLFHIGILGIFVGHFFGMLTPHWMYEAWLPIEVKQKMAMFAGGASGVLCLIGGVLLLKRRLFSPRVRATTTGADILILSLLVIQCALGLLTIPFSAQHMDGSEMMKLVGWAQSVVTFHGGASQHLDGVAFIFRLHLVLGMTLFLLFPFSRLVHIWSVPVEYLTRKYQLVRARH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus CBA/J) | spleen | BTO:0001281 | 24 h | 1,525,056 | -2.22 | 0.039 | ●○○○○ -1 | -0.9973308907754451 | 24339777 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)