Bacterial taxon 1392858
Locus CO715_21325
Protein ATI08042.1
16S rRNA pseudouridine(516) synthase
Escherichia coli M12
Length 231 aa, Gene n/a, UniProt n/a
>ATI08042.1|Escherichia coli M12|16S rRNA pseudouridine(516) synthase
MRLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQQHGPRYFMLNKPQGYVCSTDDPDHPTVLYFLDEPVAWKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLHNEKDLTKPAVLEVITPTQVRLTISEGRYHQVKRMFAAVGNHVVELHRERIGGITLDADLAPGEYRPLTEEEIASVV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.09 | 1.8e-9 | ●●○○○ -1.35 | -1.349849200961416 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.35 | 0.016 | ○○○○○ 0.83 | 0.8282065417824467 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)