Bacterial taxon 1392858   Locus CO715_09055   Protein ATI05853.1

2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

Escherichia coli M12

Length 250 aa, Gene n/a, UniProt n/a

>ATI05853.1|Escherichia coli M12|2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAAAVANQGKAK
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study2.550.042○○○○○ 1.081.077329882795586829101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study-2.320.089○○○○○ 0.060.0618497314463792429101196
Retrieved 2 of 2 entries in 1.8 ms (Link to these results)