Bacterial taxon 1392858
Locus CO715_11070
Protein ATI06194.1
2-deoxyglucose-6-phosphate phosphatase
Escherichia coli M12
Length 222 aa, Gene n/a, UniProt n/a
>ATI06194.1|Escherichia coli M12|2-deoxyglucose-6-phosphate phosphatase
MSTPRQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTELTAKDLLG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.55 | 4.0e-15 | ●●○○○ -1.24 | -1.238640875366773 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.93 | 0.01 | ○○○○○ 0.95 | 0.9481779999755419 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)