Bacterial taxon 1392858
Locus CO715_21095
Protein ATI08003.1
2-keto-3-deoxy-L-rhamnonate aldolase
Escherichia coli M12
Length 267 aa, Gene n/a, UniProt n/a
>ATI08003.1|Escherichia coli M12|2-keto-3-deoxy-L-rhamnonate aldolase
MNALLTNPFKERLRKGEVQIGLWLSSTTSYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAPYASQPVIRPVEGSKSLIKQVLDIGAQTLLIPMVDTADQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSDALDQRLAMFKSGKNGPRIKGSY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.48 | 0.029 | ●○○○○ -0.6 | -0.5974716735800223 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 4.73 | 0.032 | ○○○○○ 1.53 | 1.5338473619720954 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)