Bacterial taxon 1392858
Locus CO715_16365
Protein ATI07149.1
3-isopropylmalate dehydratase small subunit
Escherichia coli M12
Length 201 aa, Gene n/a, UniProt n/a
>ATI07149.1|Escherichia coli M12|3-isopropylmalate dehydratase small subunit
MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFTIDAFRRHCMMNGLDSIGLTLQHDDAIASYEEKQPAFMR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.11 | 0.00022 | ●●○○○ -1.56 | -1.5624594894810055 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.99 | 0.0088 | ●○○○○ -0.91 | -0.9116925710388074 | 29101196 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)