Bacterial taxon 1392858
Locus CO715_03515
Protein ATI04887.1
3-octaprenyl-4-hydroxybenzoate carboxy-lyase
Escherichia coli M12
Length 189 aa, Gene n/a, UniProt n/a
>ATI04887.1|Escherichia coli M12|3-octaprenyl-4-hydroxybenzoate carboxy-lyase
MKRLIVGISGASGAIYGVRLLQVLRDVADVETHLVMSQAARQTLSLETDFSLREVQALADVTHDARDIAASISSGSFQTLGMVILPCSIKTLSGIVHSYTDGLLTRAADVVLKERRPLVLCVRETPLHLGHLRLMTQAAEIGAVIMPPVPAFYHRPQSLDDVINQTVNRVLDQFAITLPEDLFARWQGA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.88 | 2.8e-100 | ●○○○○ -0.89 | -0.8897847395426769 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.57 | 0.013 | ●○○○○ -0.82 | -0.8244785370827833 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)