Bacterial taxon 1392858
Locus CO715_14560
Protein ATI06825.1
4'-phosphopantetheinyl transferase AcpT
Escherichia coli M12
Length 195 aa, Gene n/a, UniProt n/a
>ATI06825.1|Escherichia coli M12|4'-phosphopantetheinyl transferase AcpT
MYRIVLGKVSTLSAAPLPPALRDQAPQGPRRERWLAGRALLSHTLSPLPEIIYGEQGKPAFAPETPLWFNLSHSGDDIALLLSDEGEVGCDIEVIRPRANWRWLANAVFSLGEHAEMDAVHPDQQLEMFWRIWTRKEAIVKQRGGSAWQIVSVDSTYHSSLSVSHCQLENLSLAICTPTPFTLSADSVQWIDSVN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.53 | 9.6e-7 | ●○○○○ -0.61 | -0.6081126203067142 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 6.68 | 1.0e-40 | ○○○○○ 1.94 | 1.9388292756291352 | 29101196 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)